PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678364212
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family TALE
Protein Properties Length: 488aa    MW: 54762.7 Da    PI: 6.7076
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678364212genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.97e-083543921854
                HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                lFe   ++yp+ +e+  LA++ gL+  qV +WF N R +
  678364212 354 LFEHflHPYPTDAEKLVLATRAGLSRGQVANWFINARVR 392
                5775569******************************88 PP

2BELL92.54.1e-30221290372
       BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                ++lq k akL s+l eV++rYk y++ql+  +ssFe+vag g+a pYt++ lk++Sr+Fr L+dai+ qi
  678364212 221 HDLQDKLAKLSSMLGEVERRYKLYCNQLRLAVSSFEMVAGPGAAFPYTTITLKTMSRQFRRLQDAIKRQI 290
                789*****************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005745.6E-31152288IPR006563POX domain
PfamPF075265.3E-32159286IPR006563POX domain
SMARTSM003895.7E-8332400IPR001356Homeobox domain
PROSITE profilePS5007112.098333396IPR001356Homeobox domain
CDDcd000862.30E-10336397No hitNo description
SuperFamilySSF466894.71E-16337402IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.8E-24339400IPR009057Homeodomain-like
PfamPF059201.3E-15353392IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 488 aa     Download sequence    Send to blast
MLPSTYLVDQ KLAGLGNTEG YSNQASDSLL YQNLLSSDSV SAQEFIASEG GTRDVMLFIP  60
SKEARCSEPI SQHHGLSLSL GTQEPFPDSN NYSNSSLCSF IHQDMQLGIQ QLSQNEHMKN  120
AQFLPFGSAK TCVDSMVGSN DPSFMPVLNE GLAYADVFCN SKYIKAAQDL LHELVNVQHL  180
MAPLGKLRNA NVAAQDGSLW MDAIRGRGSE EPPESTKEKL HDLQDKLAKL SSMLGEVERR  240
YKLYCNQLRL AVSSFEMVAG PGAAFPYTTI TLKTMSRQFR RLQDAIKRQI QASERSMGKQ  300
DENATSSGTL PRLRRVDEQL RNQQAIQHLG VMRRPWRPQR SLPETAISIL RAWLFEHFLH  360
PYPTDAEKLV LATRAGLSRG QVANWFINAR VRLWKPMIED IYREEFGDEG KQPKSPPETT  420
TKNHELLDDR EDGLMAEAVS TSKRVKRDSV SLHLGLQNNE KEPSLTSATA EQNHPAPWSQ  480
FSFRPDEP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A4e-15342399562Homeobox protein Meis2
3k2a_B4e-15342399562Homeobox protein Meis2
4xrm_A5e-15342399562Homeobox protein Meis2
4xrm_B5e-15342399562Homeobox protein Meis2
5bng_A4e-15342399158Homeobox protein Meis2
5bng_B4e-15342399158Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011083616.11e-142PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_011083614.11e-142PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_011083613.11e-142PREDICTED: BEL1-like homeodomain protein 7
TrEMBLK4BVF81e-104K4BVF8_SOLLC; Uncharacterized protein
STRINGSolyc04g080790.2.11e-103(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA112582022
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19700.31e-81BEL1-like homeodomain 10